This image was acquired from
flickr. It was marked as Public Domain or CC0 and is free to use. To verify, go to the source and check the information there.
Keywords from Image Description:
uss bonhomme richard sailors lhd bhr sasebo japan usn underway deployment pacific flight deck flight mhs sea hawk osprey mv osprey hsc vmm wearebhr ussbonhommerichardsailorslhdbhrsasebojapanusnunderwaydeploymentpacificflightdeckflightmhsseahawkospreymvospreyhscvmmwearebhr philippine sea philippinesea vehicle outdoor aircraft rotor