Related Images
Download:
| Tiny | 91x128 | View | Download |
| Small | 182x256 | View | Download |
| Medium | 365x512 | View | Download |
| Large | 731x1024 | View | Download |
| Original | 2652x3712 | View | Download |
This image was acquired from
flickr. It was marked as Public Domain or CC0 and is free to use. To verify, go to the source and check the information there.
Looking for more info about this image?
Try a Google Reverse Image Search for it.
Try a Google Reverse Image Search for it.
Keywords from Image Description:
seattle seahawks marines navy sailor football nfl th ma seattleseahawksmarinesnavysailorfootballnflthma seattle washington united states unitedstates us NWX SEATTLE Oct. Master Chief Petty Officer Rich Magee stationed aboard USS City of Corpus Christi SSN poses with Blitz the Seattle Seahawks mascot during the th annual USAA Change