This image was acquired from
wikimedia. It was marked as Public Domain or CC0 and is free to use. To verify, go to the source and check the information there.
visitingscrapmetalsiteatakaafinland oreerefineries cnone scrapmetalrecycle . en Scrap metal collecting site in at Akaa Finland Winer own Ore Refineries Uploaded with Scrap metal
Page 2023 Free-images.com. All images are Public Domain