This image was acquired from
flickr. It was marked as Public Domain or CC0 and is free to use. To verify, go to the source and check the information there.
Keywords from Image Description:
nakajima ki ki hayate gale frank army type fighter hayategalefrankarmytypefighter outdoor Catalog Title Nakajima Ki Hayate ampquotampquotGaleampquotampquot Frank ampquotampquotArmy Type Fighterampquotampquot Corporation Name Nakajima Official Nickname Hayate ampquotampquotGaleampquotampquot Frank ampquotampquotArmy Type Fighterampquotampquot