Related Images
Download:
| Tiny | 191x128 | View | Download |
| Small | 383x256 | View | Download |
| Medium | 767x512 | View | Download |
| Large | 1535x1024 | View | Download |
| Original | 4849x3233 | View | Download |
This image was acquired from
flickr. It was marked as Public Domain or CC0 and is free to use. To verify, go to the source and check the information there.
Looking for more info about this image?
Try a Google Reverse Image Search for it.
Try a Google Reverse Image Search for it.
Keywords from Image Description:
secretary kerry manila philippines perfecto fm secretarykerrymanilaphilippinesperfectofm ocean our ocean conference ouroceanconference outdoor U.S. Secretary of State John Kerry poses for group photo with attendees at Young Southeast Asian Leaders Initiative YSEALI Sea and Earth Advocate Camp all holding banner touting the third