This image was acquired from
wikimedia. It was marked as Public Domain or CC0 and is free to use. To verify, go to the source and check the information there.
UCBerkeleycampanilewayatgrinnellpathway. en UC Berkeley Campus view west on Campanile Way at Grinnell Pathway own Firstcultural other versions cczero University of California Berkeley campus University of California Berkeley Uploaded with
Page 2023 Free-images.com. All images are Public Domain